PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G24650.1
Common NameF25P17.5, REM13
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family B3
Protein Properties Length: 1045aa    MW: 117805 Da    PI: 8.0148
Description DNA binding;DNA binding;sequence-specific DNA binding transcription factors
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G24650.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3421.7e-1317881090
                 HHHTT-EE--HHH.HTT.---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
           B3 10 vlksgrlvlpkkfaeeh.ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90
                 ++ ++ l++p +f++e+ +g +    +l+  d s +sWevkl  + ++    +t+GW+eFv an+ + gD+v F+++g+  f
  AT2G24650.1 17 SFHTH-LMIPEDFFSEYiEGRSV--AELK-LDFSDKSWEVKL--SDRR----ITDGWEEFVVANDFRIGDVVAFRYVGNLVF 88
                 44555.99*********855533..3577.67889*******..5555....9**********************9985333 PP

2B351.51.8e-16165252998
                  HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
           B3   9 dvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                    l+++ l+lp +f++++g+  +++++++l+d   rs  + l+++ +sg++++++GW++F+++ng k+g f++Fkl+g ++++lv++++ 
  AT2G24650.1 165 LDLTTDTLYLPLHFTSANGLT-RKNREIILTDGGERSRVLDLRFDESSGTFYISRGWRNFCDENGQKAGGFFLFKLVG-KGETLVLSFCP 252
                  4566778***********987.6788******999999999999********************************99.77778988886 PP

3B353.73.6e-17305396198
                  EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
           B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                  f++ ++p+d+ + g l+l+ +f++e+g++k++  ++ l d++gr+W   l    ++g++ l+kGWkeFvkan L++g   ++kl++ +e+++v+++++
  AT2G24650.1 305 FVTFTLPPDYARIGKLSLSAPFVRENGINKPG--EICLLDKHGRKWLTSLL-LDSKGTMSLGKGWKEFVKANSLETGF--TLKLIW-EETTPVLSLCS 396
                  7788899********************99766..8***************5.55556789*****************5..566668.77889999987 PP

4B354.52.1e-174885681598
                  -EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
           B3  15 rlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                   ++lpk f++e+g++k++   +tl  ++g + + +l ++k  g++ l+ GWk+Fvk+ngLk+gD++++kl++ +++++v++++ 
  AT2G24650.1 488 DMRLPKVFTRENGINKPG--RITLLGKDGIKQQTNLLFDKANGAMSLGHGWKDFVKDNGLKTGDSFTLKLIW-EDQTPVLSLCP 568
                  589**********99877..6***************99**********************************.78889999986 PP

5B360.33.4e-19643737199
                  EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
           B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                  f++ ++++++ k++rl+l+ +fa++++++k++  ++ l d++g +W + l+ r k+g++ l+kGWkeF++an+ k g++++ +l++ ++++++++++r
  AT2G24650.1 643 FVTLTITPSSIKKDRLILSPQFARKNNIDKPG--MIYLLDTDGTKWLISLQ-RDKKGTMSLGKGWKEFAEANDFKLGESFTMELVW-EDTTPMLSLLR 736
                  788899********************999766..8***************5.44445689**************************.88889999988 PP

                  S CS
           B3  99 k 99 
                  +
  AT2G24650.1 737 T 737
                  6 PP

6B363.72.9e-20815909199
                  EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
           B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                  f++ ++++    ++rl+l+ +fa+e++++  ++ t+ l d++gr+W  +++ r k+g++ l+kGWkeF++ ++Lk+gD+++ +l++ +++++v++++r
  AT2G24650.1 815 FVTFTITPTCVGKNRLILSAQFARENNIN--QPGTIYLLDTDGRKWLTTVK-RDKKGTMSLGKGWKEFADTKDLKSGDSFTMELIW-EDTNPVLSLLR 908
                  667778888888999***********999..5569***************5.44455689**************************.88889999988 PP

                  S CS
           B3  99 k 99 
                  +
  AT2G24650.1 909 T 909
                  6 PP

7B347.14.2e-159451033595
                   -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS..SEE..EEE CS
           B3    5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr..sefelvvk 95  
                   ltp+dv++ + l+lp +f++++g++++ + ++tl  e+g +W  ++     +g+  l++GW++F++ang+k g +++++++++  +++++v+k
  AT2G24650.1  945 LTPEDVTA-CKLILPSQFMKANGINNKLG-KITLLGENGVEWPGYM--LSLDGTLALGNGWEGFCEANGVKLGQTFTLEFVNEqdTTTTPVLK 1033
                   56666665.66***********9887665.****************..999999*************************88542355555555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.3E-16796IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.407796IPR003340B3 DNA binding domain
SuperFamilySSF1019364.71E-187101IPR015300DNA-binding pseudobarrel domain
CDDcd100178.88E-15891No hitNo description
SMARTSM010194.8E-211096IPR003340B3 DNA binding domain
PfamPF023622.2E-91785IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.3E-17149253IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.53E-19154253IPR015300DNA-binding pseudobarrel domain
CDDcd100176.30E-16157252No hitNo description
PROSITE profilePS5086313.324157253IPR003340B3 DNA binding domain
SMARTSM010194.8E-25158254IPR003340B3 DNA binding domain
PfamPF023626.6E-15163252IPR003340B3 DNA binding domain
SuperFamilySSF1019369.22E-18298395IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.8E-18301397IPR015300DNA-binding pseudobarrel domain
CDDcd100174.51E-16303396No hitNo description
SMARTSM010196.8E-30305398IPR003340B3 DNA binding domain
PfamPF023624.3E-16305396IPR003340B3 DNA binding domain
PROSITE profilePS5086313.042305398IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.1E-18448574IPR015300DNA-binding pseudobarrel domain
SMARTSM010195.8E-25478570IPR003340B3 DNA binding domain
PfamPF023621.8E-16488569IPR003340B3 DNA binding domain
SuperFamilySSF1019361.45E-19489574IPR015300DNA-binding pseudobarrel domain
CDDcd100174.15E-17489568No hitNo description
PROSITE profilePS5086311.575489570IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.4E-22637734IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019369.22E-21639737IPR015300DNA-binding pseudobarrel domain
CDDcd100173.88E-17641736No hitNo description
SMARTSM010194.3E-30643738IPR003340B3 DNA binding domain
PROSITE profilePS5086315.453643738IPR003340B3 DNA binding domain
PfamPF023625.9E-18643737IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.3E-6757794IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.6E-25806909IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.14E-20814909IPR015300DNA-binding pseudobarrel domain
SMARTSM010191.8E-28815910IPR003340B3 DNA binding domain
PROSITE profilePS5086315.227815910IPR003340B3 DNA binding domain
PfamPF023622.9E-18815909IPR003340B3 DNA binding domain
CDDcd100175.07E-17819908No hitNo description
Gene3DG3DSA:2.40.330.103.3E-179301025IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019367.85E-179381034IPR015300DNA-binding pseudobarrel domain
SMARTSM010191.5E-219401038IPR003340B3 DNA binding domain
PfamPF023621.7E-139401031IPR003340B3 DNA binding domain
PROSITE profilePS5086312.4789401035IPR003340B3 DNA binding domain
CDDcd100171.29E-139451023No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
Sequence ? help Back to Top
Protein Sequence    Length: 1045 aa     Download sequence    Send to blast
MANSRIYPQF FHTLVPSFHT HLMIPEDFFS EYIEGRSVAE LKLDFSDKSW EVKLSDRRIT  60
DGWEEFVVAN DFRIGDVVAF RYVGNLVFHV SNLGPNYYEI EHNDGESLLR KRLHQVDFSS  120
NNGDVCDSEE LPKEKKAKTN SEEADAVSSS SSADKSCFMA IITALDLTTD TLYLPLHFTS  180
ANGLTRKNRE IILTDGGERS RVLDLRFDES SGTFYISRGW RNFCDENGQK AGGFFLFKLV  240
GKGETLVLSF CPTESINGEE NITREDSKDE CSSLDSLMNI VEKKKYIPKP RGSPYSSYSP  300
SHKQFVTFTL PPDYARIGKL SLSAPFVREN GINKPGEICL LDKHGRKWLT SLLLDSKGTM  360
SLGKGWKEFV KANSLETGFT LKLIWEETTP VLSLCSPESN SDREQEEISK AIEKHSLFID  420
PSNRDKISNN DKEENMSWER KKDHLKSRDS TLSSQKQFVT ITITPSSDRL VSLSNDSCLV  480
VVSLLYFDMR LPKVFTRENG INKPGRITLL GKDGIKQQTN LLFDKANGAM SLGHGWKDFV  540
KDNGLKTGDS FTLKLIWEDQ TPVLSLCPAD CSIDREAGGG RSETNQKKSL PIEPSTCKKI  600
RKDVNIKDDN SKEKNDKEES KSVDGERKYL RGTYLTPSSQ KHFVTLTITP SSIKKDRLIL  660
SPQFARKNNI DKPGMIYLLD TDGTKWLISL QRDKKGTMSL GKGWKEFAEA NDFKLGESFT  720
MELVWEDTTP MLSLLRTEFR SSKANEKESI SSEHKTRESS PTIKNRIVTP ALTPEDVKAC  780
KLILPSQFMK KIRTVDKERN HLKGRDLNPS CQKQFVTFTI TPTCVGKNRL ILSAQFAREN  840
NINQPGTIYL LDTDGRKWLT TVKRDKKGTM SLGKGWKEFA DTKDLKSGDS FTMELIWEDT  900
NPVLSLLRTK FSSSKSNKEE SIFLEPKSRD SSSPTIVNRF VTLALTPEDV TACKLILPSQ  960
FMKANGINNK LGKITLLGEN GVEWPGYMLS LDGTLALGNG WEGFCEANGV KLGQTFTLEF  1020
VNEQDTTTTP VLKFSSVETI YKNVN
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO3341844240.0
Expression AtlasAT2G24650-
AtGenExpressAT2G24650-
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G24650.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G24650
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0069540.0AC006954.8 Arabidopsis thaliana chromosome 2 clone F25P17 map mi238, complete sequence.
GenBankCP0026850.0CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_180041.50.0B3 domain-containing protein REM13
SwissprotP0CAP50.0REM13_ARATH; B3 domain-containing protein REM13
TrEMBLA0A087GRX40.0A0A087GRX4_ARAAL; Uncharacterized protein
STRINGAT2G24650.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM137801326
Representative plantOGRP2682231
Publications ? help Back to Top
  1. Swaminathan K,Peterson K,Jack T
    The plant B3 superfamily.
    Trends Plant Sci., 2008. 13(12): p. 647-55
    [PMID:18986826]